Recombinant Streptavidin_Synbio Technologies

Home > Protein Expression > Recombinant Streptavidin

Recombinant Streptavidin

Streptavidin, renowned for its exceptional stability, maintaining its biological activity even under extreme conditions including high temperatures, varying pH levels, and denaturing environments. This tetrameric protein has biotin-binding sites on each monomer, enabling the capture of biotinylated molecules in solution. Widely used in biotechnology, streptavidin serves as an effective immobilization agent for applications such as magnetic beads, microporous plates, and membranes. It also facilitates protein conjugation through robust streptavidin-biotin interactions. Common applications include immunoluminescence, enzyme-linked immunoadsorption, and other advanced biotechnological methodologies.

Synbio Technologies produces recombinant streptavidin using E. coli expression. It is a non-glycosylated protein with a high affinity for biotin. It is ideal for use in solid phase technology and universal detection systems for immunology and molecular diagnostics.

Highlights

High Purity
High Affinity
High Stability

Product Properties

Product Name	Recombinant Streptavidin
Amino Acid Sequence	MNHKVHHHHHHDPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNA ESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWL LTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
Molecular Weight	64kDa
Expression System	Escherichia coli
Tag	N-Terminus His
Purity	SDS-PAGE ≥95%
Activity	15.0 units/mg
Usage Concentration	1 mg/ml, 5 mg/ml, 10 mg/ml (Optional)
Storage Buffer	1×PBS pH 7.4
Storage Condition	-20°C, -80°C
Specification	1mg, 10mg, 100mg (Optional)
Transportation	Blue ice

* Short-term storage can be stored in -20°C , long-term storage can be divided and stored in -80°C, to avoid repeated freeze-thaw; shelf life of one year.

Product QC View more

QUOTE

FAQs

How does streptavidin remain active?

Streptavidin is one of the most stable proteins in nature. It can maintain its biological activity at high temperatures, extreme pH, and in the presence of denaturants.

Is the production process of recombinant streptavidin safe?

Recombinant Streptavidin is expressed in E. coli and undergoes a rigorous purification and quality control process to ensure the safety and efficiency of the product.