Recombinant Streptavidin
Streptavidin, renowned for its exceptional stability, maintaining its biological activity even under extreme conditions including high temperatures, varying pH levels, and denaturing environments. This tetrameric protein has biotin-binding sites on each monomer, enabling the capture of biotinylated molecules in solution. Widely used in biotechnology, streptavidin serves as an effective immobilization agent for applications such as magnetic beads, microporous plates, and membranes. It also facilitates protein conjugation through robust streptavidin-biotin interactions. Common applications include immunoluminescence, enzyme-linked immunoadsorption, and other advanced biotechnological methodologies.
Synbio Technologies produces recombinant streptavidin using
E. coli expression. It is a non-glycosylated protein with a high affinity for biotin. It is ideal for use in solid phase technology and universal detection systems for immunology and molecular diagnostics.
Highlights
-
![]()
- High Purity
-
![]()
- High Affinity
-
![]()
- High Stability
Product Properties
|
Product Name
|
Recombinant Streptavidin
|
|
Amino Acid Sequence
|
MNHKVHHHHHHDPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNA
ESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWL
LTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
|
|
Molecular Weight
|
64kDa
|
|
Expression System
|
Escherichia coli
|
|
Tag
|
N-Terminus His
|
|
Purity
|
SDS-PAGE ≥95%
|
|
Activity
|
15.0 units/mg
|
|
Usage Concentration
|
1 mg/ml, 5 mg/ml, 10 mg/ml (Optional)
|
|
Storage Buffer
|
1×PBS pH 7.4
|
|
Storage Condition
|
-20°C, -80°C
|
|
Specification
|
1mg, 10mg, 100mg (Optional)
|
|
Transportation
|
Blue ice
|
* Short-term storage can be stored in -20°C , long-term storage can be divided and stored in -80°C, to avoid repeated freeze-thaw; shelf life of one year.
Product QC View more
Figure 1. SDS-PAGE of recombinant streptavidin, purity > 90%
FAQs
Streptavidin is one of the most stable proteins in nature. It can maintain its biological activity at high temperatures, extreme pH, and in the presence of denaturants.
Recombinant Streptavidin is expressed in E. coli and undergoes a rigorous purification and quality control process to ensure the safety and efficiency of the product.
Recombinant streptavidin is widely used in various applications such as:
- Biotin-streptavidin based assays (e.g., ELISA)
- Protein purification
- Immunohistochemistry
- Western blotting
- Medical diagnostics
- Biosensor development
Get in Touch with Us
Related Services
DNA Synthesis
Vector Selection
Molecular Biology
Oligo Synthesis
RNA Synthesis
Variant Libraries
CRISPR Libraries
Oligo Pools
Virus Packaging
Gene Editing
Protein Expression
Antibody Services
Peptide Services
DNA Data Storage
Standard Oligo
Standard CRISPR Libraries
Standard CRISPR Plasmid
ProXpress
Protein Products
