Recombinant Stretavidin
Streptavidin, renowned for its exceptional stability, maintaining biological activity even under extreme conditions such as high temperatures, varying pH levels, and denaturing environments. This tetrameric protein contains biotin-binding sites on each of its four monomers, allowing it to effectively capture biotinylated molecules in solution. Widely used in biotechnology, streptavidin acts as a powerful immobilization agent on platforms like magnetic beads, microporous plates, and membranes. Its robust streptavidin-biotin interactions are ideal for protein conjugation and are essential in applications such as immuno-luminescence, enzyme-linked immunosorbent assays (ELISA), and various other advanced biotechnological techniques.
Synbio Technologies offers recombinant streptavidin produced via
E. coli expression system. This process yields a highly purified, non-glycosylated protein with exceptional affinity for biotin, making it ideal for use in solid-phase technology and universal detection systems in immunology and
molecular diagnostics.
Highlights
-
![]()
- High Purity
-
![]()
- High Affinity
-
![]()
- High Stability
Product List
Product Properties
Product Name
|
Recombinant Streptavidin
|
Amino Acid Sequence
|
MNHKVHHHHHHDPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNA
ESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWL
LTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
|
Molecular Weight
|
64kDa
|
Expression System
|
Escherichia coli
|
Tag
|
N-Terminus His
|
Purity
|
SDS-PAGE ≥95%
|
Activity
|
15.0 units/mg
|
Usage Concentration
|
1 mg/ml, 5 mg/ml, 10 mg/ml (Optional)
|
Storage Buffer
|
1×PBS pH 7.4
|
Storage Condition
|
-20°C, -80°C
|
Specification
|
1mg, 10mg, 100mg (Optional)
|
Transportation
|
Blue ice
|
* Short-term storage can be stored in -20°C ; it is recommended for long-term storage to be aliquoted and stored in -80°C, avoiding repeated freeze-thaw; shelf life of one year.
Product QC View More
Figure 1. SDS-PAGE of recombinant streptavidin, purity > 90%
FAQs
Streptavidin is one of the most stable proteins in nature, not breaking down even at high temperatures, extreme pH, and in the presence of denaturants. This is due to its unique structural and chemical properties such as its tetrameric structure and high biotin affinity..
The production process is extremely safe. Recombinant Streptavidin is expressed in E. coli and undergoes a rigorous purification and quality control process to ensure the safety and efficiency of the product.
Recombinant streptavidin is widely used in various applications such as:
- Biotin-streptavidin based assays (e.g., ELISA)
- Protein purification
- Immunohistochemistry
- Western blotting
- Medical diagnostics
- Biosensor development
Get in Touch with Us
Related Services