Recombinant Streptavidin
High Affinity, High Stability, High Purity
Home > Protein Products > Recombinant Stretavidin
Recombinant Stretavidin
Streptavidin, renowned for its exceptional stability, maintaining biological activity even under extreme conditions such as high temperatures, varying pH levels, and denaturing environments. This tetrameric protein contains biotin-binding sites on each of its four monomers, allowing it to effectively capture biotinylated molecules in solution. Widely used in biotechnology, streptavidin acts as a powerful immobilization agent on platforms like magnetic beads, microporous plates, and membranes. Its robust streptavidin-biotin interactions are ideal for protein conjugation and are essential in applications such as immuno-luminescence, enzyme-linked immunosorbent assays (ELISA), and various other advanced biotechnological techniques.

Synbio Technologies offers recombinant streptavidin produced via E. coli expression system. This process yields a highly purified, non-glycosylated protein with exceptional affinity for biotin, making it ideal for use in solid-phase technology and universal detection systems in immunology and molecular diagnostics.
Highlights
  • High Purity
  • High Affinity
  • High Stability
Product List

Product Properties

Product Name Recombinant Streptavidin
Amino Acid Sequence MNHKVHHHHHHDPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNA
ESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWL
LTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
Molecular Weight 64kDa
Expression System Escherichia coli
Tag N-Terminus His
Purity SDS-PAGE ≥95%
Activity 15.0 units/mg
Usage Concentration 1 mg/ml, 5 mg/ml, 10 mg/ml (Optional)
Storage Buffer 1×PBS pH 7.4
Storage Condition -20°C, -80°C
Specification 1mg, 10mg, 100mg (Optional)
Transportation Blue ice

* Short-term storage can be stored in -20°C ; it is recommended for long-term storage to be aliquoted and stored in -80°C, avoiding repeated freeze-thaw; shelf life of one year.


FAQs
Get in Touch with Us
Related Services
  • Address:
    9 Deer Park Dr., Suite J-25
    Monmouth Junction, NJ 08852
  • Tel: +1 732-230-3003
  • Fax: +1 609-228-5911
  • Inquiries: quote@synbio-tech.com

This website stores cookies on your computer. These cookies are used to collect information about how you interact with our website and allow us to remember you.
To find out more about the cookies we use, see our Privacy Policy.

Accept